PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G21070.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 602aa    MW: 66532.1 Da    PI: 5.2967
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G21070.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-18169216148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++l ++v+ +G g+W+++ r  g++R++k+c++rw ++l
  OMERI06G21070.3 169 KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL 216
                      79******************************************9986 PP

2Myb_DNA-binding41.92.3e-13222265146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+e +++++  lG++ W++ a+ ++ gRt++++k++w++
  OMERI06G21070.3 222 KGPFSKEEEEMIIKLHLWLGNK-WAKMANSLP-GRTDNEIKNFWNT 265
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.639164220IPR017930Myb domain
SuperFamilySSF466893.56E-30166263IPR009057Homeodomain-like
SMARTSM007175.2E-16168218IPR001005SANT/Myb domain
PfamPF002495.4E-17169216IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-24170223IPR009057Homeodomain-like
CDDcd001676.20E-12171216No hitNo description
SMARTSM007171.9E-12221269IPR001005SANT/Myb domain
PROSITE profilePS5129416.24221271IPR017930Myb domain
PfamPF002495.0E-12222265IPR001005SANT/Myb domain
CDDcd001671.71E-9224265No hitNo description
Gene3DG3DSA:1.10.10.601.1E-23224269IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MQYCKPRLHR WIVLCMQTLV GPPRDGSPFR PRTRTIVIGG RLLLASSSLL RLVYYSTSLS  60
AAVAAAAAAD SLVSTPVSTL PRWRSTRRLM RMEGSSPMEE DEPAAMLAGS QGESPAMLYP  120
SGDGDRDGDD DEGDASGGEE EQGGVARAGV RRRGGGVRVR VRGRIPLKKG PWTPDEDKRL  180
REYVEAHGEG NWNRVQRNAG LNRCGKSCRL RWANHLKPDL KKGPFSKEEE EMIIKLHLWL  240
GNKWAKMANS LPGRTDNEIK NFWNTRCKRI QRTGEPLYPK EFNHFKLTDL EVMNCESPDE  300
SRAKKRTNEV LQGNGQSYKE VFFDNLDYSR PENYIRPNCV TPNSLPVDAT SPFGSAIATQ  360
DQSVPFGSAI VSGHPILDGN FSTSGTIQRP MNVELPSLQY PNYDFNNNNA WSYHDPLGHP  420
IDQVDFGSLR SEYLSPNNNG LLDALVHGGH GQGELANSQG SFDACFPRVQ CNQVIQSNAF  480
SLSSSFPIIG DDLLENSCHA FVGINNNASS LFLDSQPPPL VDPTFWRHDV SLEPNLPVYC  540
QFNEELPPSN EQFAKDADDA FGHGGLSDET NLAAAGQGDE HDLENPWASM PGACDIPDFP  600
SE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-281672695106B-MYB
1h8a_C1e-2716726925126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2120750.0AB212075.1 Oryza sativa Japonica Group mRNA for GAMYB-like1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641123.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A0E0E3P60.0A0A0E0E3P6_9ORYZ; Uncharacterized protein
STRINGORGLA06G0168900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-54myb domain protein 101